Lineage for d6h6kb1 (6h6k B:2-206)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448880Protein automated matches [190047] (30 species)
    not a true protein
  7. 2449351Species Sulfolobus solfataricus [TaxId:273057] [256083] (13 PDB entries)
  8. 3067702Domain d6h6kb1: 6h6k B:2-206 [367764]
    Other proteins in same PDB: d6h6ka2, d6h6ka3, d6h6kb2, d6h6kb3, d6h6kc2, d6h6kc3, d6h6kd2, d6h6kd3, d6h6ke2, d6h6ke3
    automated match to d2qn6a3
    complexed with edo, gcp, na; mutant

Details for d6h6kb1

PDB Entry: 6h6k (more details), 2 Å

PDB Description: the structure of the fkr mutant of the archaeal translation initiation factor 2 gamma subunit in complex with gdpcp, obtained in the absence of magnesium salts in the crystallization solution.
PDB Compounds: (B:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d6h6kb1:

Sequence, based on SEQRES records: (download)

>d6h6kb1 c.37.1.8 (B:2-206) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy

Sequence, based on observed residues (ATOM records): (download)

>d6h6kb1 c.37.1.8 (B:2-206) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtsrgmtiklgyaetnigvcesckkpeay
vtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpq
trehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhk
inidsliegieeyiktpy

SCOPe Domain Coordinates for d6h6kb1:

Click to download the PDB-style file with coordinates for d6h6kb1.
(The format of our PDB-style files is described here.)

Timeline for d6h6kb1:

  • d6h6kb1 appears in periodic updates to SCOPe 2.07 starting on 2019-04-18