Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (29 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:273057] [256084] (13 PDB entries) |
Domain d6h6ke2: 6h6k E:207-320 [367768] Other proteins in same PDB: d6h6ka1, d6h6ka3, d6h6kb1, d6h6kb3, d6h6kc1, d6h6kc3, d6h6kd1, d6h6kd3, d6h6ke1, d6h6ke3 automated match to d4m53a2 complexed with edo, gcp, na; mutant |
PDB Entry: 6h6k (more details), 2 Å
SCOPe Domain Sequences for d6h6ke2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h6ke2 b.43.3.0 (E:207-320) automated matches {Sulfolobus solfataricus [TaxId: 273057]} rdlsqkpvmlvirsadvnapgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk vsyepiftkissiafgdeefkeakpgglvaigtyldpsltkadnllgsiitlad
Timeline for d6h6ke2: