PDB entry 6h6k

View 6h6k on RCSB PDB site
Description: The structure of the FKR mutant of the archaeal translation initiation factor 2 gamma subunit in complex with GDPCP, obtained in the absence of magnesium salts in the crystallization solution.
Class: translation
Keywords: translation initiation, aIF2, aIF2gamma, aIF2gamma switches, G-protein, GTP-binding domain, translation GTPases, GTP hydrolysis, conformational changes, magnesium ions, TRANSLATION
Deposited on 2018-07-27, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) [TaxId:273057]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q980A5 (Start-414)
      • engineered mutation (220)
      • engineered mutation (224)
      • engineered mutation (279)
    Domains in SCOPe 2.07: d6h6ka1, d6h6ka2, d6h6ka3
  • Chain 'B':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) [TaxId:273057]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q980A5 (Start-414)
      • engineered mutation (220)
      • engineered mutation (224)
      • engineered mutation (279)
    Domains in SCOPe 2.07: d6h6kb1, d6h6kb2, d6h6kb3
  • Chain 'C':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) [TaxId:273057]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q980A5 (Start-414)
      • engineered mutation (220)
      • engineered mutation (224)
      • engineered mutation (279)
    Domains in SCOPe 2.07: d6h6kc1, d6h6kc2, d6h6kc3
  • Chain 'D':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) [TaxId:273057]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q980A5 (Start-414)
      • engineered mutation (220)
      • engineered mutation (224)
      • engineered mutation (279)
    Domains in SCOPe 2.07: d6h6kd1, d6h6kd2, d6h6kd3
  • Chain 'E':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) [TaxId:273057]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q980A5 (Start-414)
      • engineered mutation (220)
      • engineered mutation (224)
      • engineered mutation (279)
    Domains in SCOPe 2.07: d6h6ke1, d6h6ke2, d6h6ke3
  • Heterogens: GCP, NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h6kA (A:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsadvnapgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissiafgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h6kA (A:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkgmtiklgyaetnigvcesc
    kkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaane
    pfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiip
    vsalhkinidsliegieeyiktpyrdlsqkpvmlvirsadvnapgtqfnelkggviggsi
    iqglfkvdqeikvlpglrvekqgkvsyepiftkissiafgdeefkeakpgglvaigtyld
    psltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsvg
    ssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h6kB (B:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsadvnapgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissiafgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h6kB (B:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtsrgmtiklgyaetnigvcesckkpeay
    vtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpq
    trehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhk
    inidsliegieeyiktpyrdlsqkpvmlvirsadvnapgtqfnelkggviggsiiqglfk
    vdqeikvlpglrvekqgkvsyepiftkissiafgdeefkeakpgglvaigtyldpsltka
    dnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlg
    ivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6h6kC (C:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsadvnapgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissiafgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h6kC (C:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelrgmtiklgyaetnigvcesc
    kkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaane
    pfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiip
    vsalhkinidsliegieeyiktpyrdlsqkpvmlvirsadvnapgtqfnelkggviggsi
    iqglfkvdqeikvlpglrvekqgkvsyepiftkissiafgdeefkeakpgglvaigtyld
    psltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsvg
    ssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6h6kD (D:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsadvnapgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissiafgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h6kD (D:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhsemtiklgyaetnigvcesckkpe
    ayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpq
    pqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsal
    hkinidsliegieeyiktpyrdlsqkpvmlvirsadvnapgtqfnelkggviggsiiqgl
    fkvdqeikvlpglrvekqgkvsyepiftkissiafgdeefkeakpgglvaigtyldpslt
    kadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsvgsstt
    lgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6h6kE (E:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsadvnapgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissiafgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h6kE (E:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtsmtiklgyaetnigvcesckkpeayvt
    epsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqtr
    ehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhkin
    idsliegieeyiktpyrdlsqkpvmlvirsadvnapgtqfnelkggviggsiiqglfkvd
    qeikvlpglrvekqgkvsyepiftkissiafgdeefkeakpgglvaigtyldpsltkadn
    llgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgiv
    tsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei