SCOPe 2.08: Domain d5z4ue_: 5z4u E:

Lineage for d5z4ue_ (5z4u E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)

8. Domain d5z4ue_: 5z4u E: [363018]
   Other proteins in same PDB: d5z4ua1, d5z4ua2, d5z4ub1, d5z4ub2, d5z4uc1, d5z4uc2, d5z4ud1, d5z4ud2, d5z4uf1, d5z4uf2
   automated match to d4i55e_
   complexed with 96c, acp, ca, gdp, gtp, mes, mg

Details for d5z4ue_

PDB Entry: 5z4u, 3.18 Å

PDB Description: crystal structure of t2r-ttl complex with 7a3

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5z4ue_:

Sequence, based on SEQRES records:

>d5z4ue_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records):

>d5z4ue_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppdpsleeiqkkleaaeerrkyqeaellkhlaekrehere
viqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelke

Timeline for d5z4ue_:

• d5z4ue_ first appeared in SCOPe 2.07