SCOPe 2.08: Domain d5z4uf1: 5z4u F:1-76

Lineage for d5z4uf1 (5z4u F:1-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)

6. Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [311384] (187 PDB entries)

8. Domain d5z4uf1: 5z4u F:1-76 [362959]
   Other proteins in same PDB: d5z4ua1, d5z4ua2, d5z4ub1, d5z4ub2, d5z4uc1, d5z4uc2, d5z4ud1, d5z4ud2, d5z4ue_, d5z4uf2
   automated match to d3tiia1
   complexed with 96c, acp, ca, gdp, gtp, mes, mg

Details for d5z4uf1

PDB Entry: 5z4u, 3.18 Å

PDB Description: crystal structure of t2r-ttl complex with 7a3

PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d5z4uf1:

Sequence; same for both SEQRES and ATOM records:

>d5z4uf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

Timeline for d5z4uf1:

• d5z4uf1 first appeared in SCOPe 2.07