SCOPe 2.08: Domain d5z4uc2: 5z4u C:246-440

Lineage for d5z4uc2 (5z4u C:246-440)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)

Domain d5z4uc2: 5z4u C:246-440 [362954]
Other proteins in same PDB: d5z4ua1, d5z4ub1, d5z4uc1, d5z4ud1, d5z4ue_, d5z4uf1, d5z4uf2
automated match to d4i50a2
complexed with 96c, acp, ca, gdp, gtp, mes, mg

Details for d5z4uc2

PDB Entry: 5z4u (more details), 3.18 Å

PDB Description: crystal structure of t2r-ttl complex with 7a3

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5z4uc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z4uc2 d.79.2.1 (C:246-440) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d5z4uc2:

Click to download the PDB-style file with coordinates for d5z4uc2.
(The format of our PDB-style files is described here.)

Timeline for d5z4uc2: