SCOPe 2.07: Domain d5z4uc1: 5z4u C:1-245

Lineage for d5z4uc1 (5z4u C:1-245)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (7 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [278810] (14 PDB entries)

8. Domain d5z4uc1: 5z4u C:1-245 [362953]
   Other proteins in same PDB: d5z4ua2, d5z4ub2, d5z4uc2, d5z4ud2, d5z4ue_, d5z4uf1, d5z4uf2
   automated match to d5fnva1
   complexed with 96c, acp, ca, gdp, gtp, mes, mg

Details for d5z4uc1

PDB Entry: 5z4u, 3.18 Å

PDB Description: crystal structure of t2r-ttl complex with 7a3

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5z4uc1:

Sequence; same for both SEQRES and ATOM records:

>d5z4uc1 c.32.1.1 (C:1-245) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d5z4uc1:

• d5z4uc1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-24