Lineage for d5z4ud1 (5z4u D:1-243)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2445283Protein automated matches [226837] (7 species)
    not a true protein
  7. 2445493Species Sheep (Ovis aries) [TaxId:9940] [224884] (19 PDB entries)
  8. 3062938Domain d5z4ud1: 5z4u D:1-243 [363000]
    Other proteins in same PDB: d5z4ua2, d5z4ub2, d5z4uc2, d5z4ud2, d5z4ue_, d5z4uf1, d5z4uf2
    automated match to d4drxb1
    complexed with 96c, acp, ca, gdp, gtp, mes, mg

Details for d5z4ud1

PDB Entry: 5z4u (more details), 3.18 Å

PDB Description: crystal structure of t2r-ttl complex with 7a3
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5z4ud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z4ud1 c.32.1.1 (D:1-243) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d5z4ud1:

Click to download the PDB-style file with coordinates for d5z4ud1.
(The format of our PDB-style files is described here.)

Timeline for d5z4ud1:

  • d5z4ud1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-24