Lineage for d5z4ub2 (5z4u B:244-428)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525736Species Sheep (Ovis aries) [TaxId:9940] [226224] (18 PDB entries)
  8. 3062894Domain d5z4ub2: 5z4u B:244-428 [362956]
    Other proteins in same PDB: d5z4ua1, d5z4ub1, d5z4uc1, d5z4ud1, d5z4ue_, d5z4uf1, d5z4uf2
    automated match to d3rycd2
    complexed with 96c, acp, ca, gdp, gtp, mes, mg

Details for d5z4ub2

PDB Entry: 5z4u (more details), 3.18 Å

PDB Description: crystal structure of t2r-ttl complex with 7a3
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5z4ub2:

Sequence, based on SEQRES records: (download)

>d5z4ub2 d.79.2.1 (B:244-428) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records): (download)

>d5z4ub2 d.79.2.1 (B:244-428) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsqyraltvpeltqqmfdaknmmaacdprh
gryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatf
ignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqd
a

SCOPe Domain Coordinates for d5z4ub2:

Click to download the PDB-style file with coordinates for d5z4ub2.
(The format of our PDB-style files is described here.)

Timeline for d5z4ub2:

  • d5z4ub2 appears in periodic updates to SCOPe 2.07 starting on 2019-01-24