![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein automated matches [226837] (9 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries) |
![]() | Domain d5z4ua1: 5z4u A:1-245 [363006] Other proteins in same PDB: d5z4ua2, d5z4ub2, d5z4uc2, d5z4ud2, d5z4ue_, d5z4uf1, d5z4uf2 automated match to d5fnva1 complexed with 96c, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 5z4u (more details), 3.18 Å
SCOPe Domain Sequences for d5z4ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z4ua1 c.32.1.1 (A:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]} mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita slrfd
Timeline for d5z4ua1: