Lineage for d3tiia1 (3tii A:2-76)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862155Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2862156Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2862333Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [310976] (3 PDB entries)
  8. 2862334Domain d3tiia1: 3tii A:2-76 [306550]
    Other proteins in same PDB: d3tiia2, d3tiia3, d3tiib2, d3tiib3
    complexed with anp, mg

Details for d3tiia1

PDB Entry: 3tii (more details), 2.5 Å

PDB Description: Tubulin tyrosine ligase
PDB Compounds: (A:) Ttl protein

SCOPe Domain Sequences for d3tiia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tiia1 c.30.1.9 (A:2-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
ytfvvrdenstvyaevakillasgqwkrlkrdnpkfnlmlgernrlpfgrlghepglvql
vnyyrgadklcrkas

SCOPe Domain Coordinates for d3tiia1:

Click to download the PDB-style file with coordinates for d3tiia1.
(The format of our PDB-style files is described here.)

Timeline for d3tiia1: