Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein) |
Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species) |
Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [310976] (3 PDB entries) |
Domain d3tiia1: 3tii A:2-76 [306550] Other proteins in same PDB: d3tiia2, d3tiia3, d3tiib2, d3tiib3 complexed with anp, mg |
PDB Entry: 3tii (more details), 2.5 Å
SCOPe Domain Sequences for d3tiia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tiia1 c.30.1.9 (A:2-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]} ytfvvrdenstvyaevakillasgqwkrlkrdnpkfnlmlgernrlpfgrlghepglvql vnyyrgadklcrkas
Timeline for d3tiia1: