SCOPe 2.08: Domain d6ezjx1: 6ezj X:11-95

Lineage for d6ezjx1 (6ezj X:11-95)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (23 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [259809] (11 PDB entries)

8. Domain d6ezjx1: 6ezj X:11-95 [350373]
   Other proteins in same PDB: d6ezja2, d6ezjb2, d6ezjc2, d6ezjd2, d6ezje2, d6ezjf2, d6ezjg2, d6ezjh2, d6ezji2, d6ezjj2, d6ezjk2, d6ezjl2, d6ezjm2, d6ezjn2, d6ezjo2, d6ezjp2, d6ezjq2, d6ezjr2, d6ezjs2, d6ezjt2, d6ezju2, d6ezjv2, d6ezjw2, d6ezjx2
   automated match to d4mu3a1
   complexed with 5ld, mn

Details for d6ezjx1

PDB Entry: 6ezj, 3.1 Å

PDB Description: imidazoleglycerol-phosphate dehydratase

PDB Compounds: (X:) Imidazoleglycerol-phosphate dehydratase 2, chloroplastic

SCOPe Domain Sequences for d6ezjx1:

Sequence; same for both SEQRES and ATOM records:

>d6ezjx1 d.14.1.0 (X:11-95) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdthi
ddhhtnedvalaigtallkalgerk

Timeline for d6ezjx1:

• d6ezjx1 first appeared in SCOPe 2.07