| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
| Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins) duplication; there are two structural repeats of this fold |
| Protein automated matches [254526] (2 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255158] (11 PDB entries) |
| Domain d6ezjn2: 6ezj N:96-195 [350770] Other proteins in same PDB: d6ezja1, d6ezjb1, d6ezjc1, d6ezjd1, d6ezje1, d6ezjf1, d6ezjg1, d6ezjh1, d6ezji1, d6ezjj1, d6ezjk1, d6ezjl1, d6ezjm1, d6ezjn1, d6ezjo1, d6ezjp1, d6ezjq1, d6ezjr1, d6ezjs1, d6ezjt1, d6ezju1, d6ezjv1, d6ezjw1, d6ezjx1 automated match to d4mu3a2 complexed with 5ld, mn |
PDB Entry: 6ezj (more details), 3.1 Å
SCOPe Domain Sequences for d6ezjn2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ezjn2 d.14.1.9 (N:96-195) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg
mtlhirqlagknshhiieatfkafaralrqatesdprrgg
Timeline for d6ezjn2:
View in 3DDomains from other chains: (mouse over for more information) d6ezja1, d6ezja2, d6ezjb1, d6ezjb2, d6ezjc1, d6ezjc2, d6ezjd1, d6ezjd2, d6ezje1, d6ezje2, d6ezjf1, d6ezjf2, d6ezjg1, d6ezjg2, d6ezjh1, d6ezjh2, d6ezji1, d6ezji2, d6ezjj1, d6ezjj2, d6ezjk1, d6ezjk2, d6ezjl1, d6ezjl2, d6ezjm1, d6ezjm2, d6ezjo1, d6ezjo2, d6ezjp1, d6ezjp2, d6ezjq1, d6ezjq2, d6ezjr1, d6ezjr2, d6ezjs1, d6ezjs2, d6ezjt1, d6ezjt2, d6ezju1, d6ezju2, d6ezjv1, d6ezjv2, d6ezjw1, d6ezjw2, d6ezjx1, d6ezjx2 |