Lineage for d6ezjh2 (6ezj H:96-195)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930730Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
    duplication; there are two structural repeats of this fold
  6. 2930753Protein automated matches [254526] (2 species)
    not a true protein
  7. 2930779Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255158] (11 PDB entries)
  8. 2930833Domain d6ezjh2: 6ezj H:96-195 [350363]
    Other proteins in same PDB: d6ezja1, d6ezjb1, d6ezjc1, d6ezjd1, d6ezje1, d6ezjf1, d6ezjg1, d6ezjh1, d6ezji1, d6ezjj1, d6ezjk1, d6ezjl1, d6ezjm1, d6ezjn1, d6ezjo1, d6ezjp1, d6ezjq1, d6ezjr1, d6ezjs1, d6ezjt1, d6ezju1, d6ezjv1, d6ezjw1, d6ezjx1
    automated match to d4mu3a2
    complexed with 5ld, mn

Details for d6ezjh2

PDB Entry: 6ezj (more details), 3.1 Å

PDB Description: imidazoleglycerol-phosphate dehydratase
PDB Compounds: (H:) Imidazoleglycerol-phosphate dehydratase 2, chloroplastic

SCOPe Domain Sequences for d6ezjh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ezjh2 d.14.1.9 (H:96-195) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg
mtlhirqlagknshhiieatfkafaralrqatesdprrgg

SCOPe Domain Coordinates for d6ezjh2:

Click to download the PDB-style file with coordinates for d6ezjh2.
(The format of our PDB-style files is described here.)

Timeline for d6ezjh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ezjh1
View in 3D
Domains from other chains:
(mouse over for more information)
d6ezja1, d6ezja2, d6ezjb1, d6ezjb2, d6ezjc1, d6ezjc2, d6ezjd1, d6ezjd2, d6ezje1, d6ezje2, d6ezjf1, d6ezjf2, d6ezjg1, d6ezjg2, d6ezji1, d6ezji2, d6ezjj1, d6ezjj2, d6ezjk1, d6ezjk2, d6ezjl1, d6ezjl2, d6ezjm1, d6ezjm2, d6ezjn1, d6ezjn2, d6ezjo1, d6ezjo2, d6ezjp1, d6ezjp2, d6ezjq1, d6ezjq2, d6ezjr1, d6ezjr2, d6ezjs1, d6ezjs2, d6ezjt1, d6ezjt2, d6ezju1, d6ezju2, d6ezjv1, d6ezjv2, d6ezjw1, d6ezjw2, d6ezjx1, d6ezjx2