Lineage for d6ezjw1 (6ezj W:11-95)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931148Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [259809] (11 PDB entries)
  8. 2931188Domain d6ezjw1: 6ezj W:11-95 [350632]
    Other proteins in same PDB: d6ezja2, d6ezjb2, d6ezjc2, d6ezjd2, d6ezje2, d6ezjf2, d6ezjg2, d6ezjh2, d6ezji2, d6ezjj2, d6ezjk2, d6ezjl2, d6ezjm2, d6ezjn2, d6ezjo2, d6ezjp2, d6ezjq2, d6ezjr2, d6ezjs2, d6ezjt2, d6ezju2, d6ezjv2, d6ezjw2, d6ezjx2
    automated match to d4mu3a1
    complexed with 5ld, mn

Details for d6ezjw1

PDB Entry: 6ezj (more details), 3.1 Å

PDB Description: imidazoleglycerol-phosphate dehydratase
PDB Compounds: (W:) Imidazoleglycerol-phosphate dehydratase 2, chloroplastic

SCOPe Domain Sequences for d6ezjw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ezjw1 d.14.1.0 (W:11-95) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdthi
ddhhtnedvalaigtallkalgerk

SCOPe Domain Coordinates for d6ezjw1:

Click to download the PDB-style file with coordinates for d6ezjw1.
(The format of our PDB-style files is described here.)

Timeline for d6ezjw1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ezjw2
View in 3D
Domains from other chains:
(mouse over for more information)
d6ezja1, d6ezja2, d6ezjb1, d6ezjb2, d6ezjc1, d6ezjc2, d6ezjd1, d6ezjd2, d6ezje1, d6ezje2, d6ezjf1, d6ezjf2, d6ezjg1, d6ezjg2, d6ezjh1, d6ezjh2, d6ezji1, d6ezji2, d6ezjj1, d6ezjj2, d6ezjk1, d6ezjk2, d6ezjl1, d6ezjl2, d6ezjm1, d6ezjm2, d6ezjn1, d6ezjn2, d6ezjo1, d6ezjo2, d6ezjp1, d6ezjp2, d6ezjq1, d6ezjq2, d6ezjr1, d6ezjr2, d6ezjs1, d6ezjs2, d6ezjt1, d6ezjt2, d6ezju1, d6ezju2, d6ezjv1, d6ezjv2, d6ezjx1, d6ezjx2