| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
| Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
| Protein automated matches [190826] (23 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [259809] (11 PDB entries) |
| Domain d4mu3a1: 4mu3 A:9-95 [259810] Other proteins in same PDB: d4mu3a2 automated match to d2f1da1 complexed with edo, ig2, iyp, mn; mutant |
PDB Entry: 4mu3 (more details), 1.12 Å
SCOPe Domain Sequences for d4mu3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mu3a1 d.14.1.0 (A:9-95) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sarigevkretkqtnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt
hiddhhtnedvalaigtallkalgerk
Timeline for d4mu3a1: