| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
| Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
| Protein automated matches [190826] (23 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [259809] (11 PDB entries) |
| Domain d6ezjh1: 6ezj H:11-95 [350362] Other proteins in same PDB: d6ezja2, d6ezjb2, d6ezjc2, d6ezjd2, d6ezje2, d6ezjf2, d6ezjg2, d6ezjh2, d6ezji2, d6ezjj2, d6ezjk2, d6ezjl2, d6ezjm2, d6ezjn2, d6ezjo2, d6ezjp2, d6ezjq2, d6ezjr2, d6ezjs2, d6ezjt2, d6ezju2, d6ezjv2, d6ezjw2, d6ezjx2 automated match to d4mu3a1 complexed with 5ld, mn |
PDB Entry: 6ezj (more details), 3.1 Å
SCOPe Domain Sequences for d6ezjh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ezjh1 d.14.1.0 (H:11-95) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdthi
ddhhtnedvalaigtallkalgerk
Timeline for d6ezjh1:
View in 3DDomains from other chains: (mouse over for more information) d6ezja1, d6ezja2, d6ezjb1, d6ezjb2, d6ezjc1, d6ezjc2, d6ezjd1, d6ezjd2, d6ezje1, d6ezje2, d6ezjf1, d6ezjf2, d6ezjg1, d6ezjg2, d6ezji1, d6ezji2, d6ezjj1, d6ezjj2, d6ezjk1, d6ezjk2, d6ezjl1, d6ezjl2, d6ezjm1, d6ezjm2, d6ezjn1, d6ezjn2, d6ezjo1, d6ezjo2, d6ezjp1, d6ezjp2, d6ezjq1, d6ezjq2, d6ezjr1, d6ezjr2, d6ezjs1, d6ezjs2, d6ezjt1, d6ezjt2, d6ezju1, d6ezju2, d6ezjv1, d6ezjv2, d6ezjw1, d6ezjw2, d6ezjx1, d6ezjx2 |