SCOPe 2.08: Domain d5n9zh1: 5n9z H:4-153

Lineage for d5n9zh1 (5n9z H:4-153)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Thalassiosira hyalina [TaxId:1234817] [346764] (1 PDB entry)

8. Domain d5n9zh1: 5n9z H:4-153 [346931]
   Other proteins in same PDB: d5n9za2, d5n9zb2, d5n9zc2, d5n9zd2, d5n9ze2, d5n9zf2, d5n9zg2, d5n9zh2, d5n9zi_, d5n9zj_, d5n9zk_, d5n9zl_, d5n9zm_, d5n9zn_, d5n9zo_, d5n9zp_
   automated match to d1bwva2
   complexed with cap, edo, mg

Details for d5n9zh1

PDB Entry: 5n9z, 1.9 Å

PDB Description: rubisco from thalassiosira hyalina

PDB Compounds: (H:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d5n9zh1:

Sequence; same for both SEQRES and ATOM records:

>d5n9zh1 d.58.9.0 (H:4-153) automated matches {Thalassiosira hyalina [TaxId: 1234817]}
svsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaavag
esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas
iignvfgfkaisalrledmriphsylxtfq

Timeline for d5n9zh1:

• d5n9zh1 first appeared in SCOPe 2.07