Lineage for d5n9ze2 (5n9z E:154-484)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838730Protein automated matches [226984] (16 species)
    not a true protein
  7. 2838941Species Thalassiosira hyalina [TaxId:1234817] [346766] (1 PDB entry)
  8. 2838946Domain d5n9ze2: 5n9z E:154-484 [346767]
    Other proteins in same PDB: d5n9za1, d5n9zb1, d5n9zc1, d5n9zd1, d5n9ze1, d5n9zf1, d5n9zg1, d5n9zh1, d5n9zi_, d5n9zj_, d5n9zk_, d5n9zl_, d5n9zm_, d5n9zn_, d5n9zo_, d5n9zp_
    automated match to d1bwva1
    complexed with cap, edo, mg

Details for d5n9ze2

PDB Entry: 5n9z (more details), 1.9 Å

PDB Description: rubisco from thalassiosira hyalina
PDB Compounds: (E:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d5n9ze2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n9ze2 c.1.14.1 (E:154-484) automated matches {Thalassiosira hyalina [TaxId: 1234817]}
gpatgiivererlnkygtpllgatvkpklglsgknygrvvyeglxggldflkddeninsq
pfmrwrerflncleginraaaatgevkgsylnitaatmeevykraeyakaigsvvvmidl
vmgytaiqsiaywarendmllhlhragnstyarqknhginfrvickwmrmsgvdhihagt
vvgklegdplmikgfydvlrltelevnlpfgiffemdwaslrrcmpvasggihcgqmhql
ihylgddvvlqfgggtighpdgiqagatanrvaleamvlarnegadyfnnqvgpqilrda
aktcgplqtaldlwkdisfnytstdtadfae

SCOPe Domain Coordinates for d5n9ze2:

Click to download the PDB-style file with coordinates for d5n9ze2.
(The format of our PDB-style files is described here.)

Timeline for d5n9ze2: