![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) ![]() |
![]() | Family d.73.1.0: automated matches [336551] (1 protein) not a true family |
![]() | Protein automated matches [336552] (9 species) not a true protein |
![]() | Species Thalassiosira hyalina [TaxId:1234817] [346774] (1 PDB entry) |
![]() | Domain d5n9zp_: 5n9z P: [346898] Other proteins in same PDB: d5n9za1, d5n9za2, d5n9zb1, d5n9zb2, d5n9zc1, d5n9zc2, d5n9zd1, d5n9zd2, d5n9ze1, d5n9ze2, d5n9zf1, d5n9zf2, d5n9zg1, d5n9zg2, d5n9zh1, d5n9zh2 automated match to d1iwab_ complexed with cap, edo, mg |
PDB Entry: 5n9z (more details), 1.9 Å
SCOPe Domain Sequences for d5n9zp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n9zp_ d.73.1.0 (P:) automated matches {Thalassiosira hyalina [TaxId: 1234817]} mrltqgcfsflpdltdqqiekqvtyamnrgwamnvewtddphprnnywelwglplfdikd patvmfelnearkscaagyirvnafdasygtescvmsfitnrpanepgfyldrtegvgrq viysiksysvqanpegsry
Timeline for d5n9zp_: