PDB entry 5n9z

View 5n9z on RCSB PDB site
Description: Rubisco from Thalassiosira hyalina
Class: photosynthesis
Keywords: photosynthesis, carbon dioxide fixation, photorespiration
Deposited on 2017-02-27, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Thalassiosira hyalina [TaxId:1234817]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N9Z
    Domains in SCOPe 2.07: d5n9za1, d5n9za2
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Thalassiosira hyalina [TaxId:1234817]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N9Z
    Domains in SCOPe 2.07: d5n9zb1, d5n9zb2
  • Chain 'C':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Thalassiosira hyalina [TaxId:1234817]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N9Z
    Domains in SCOPe 2.07: d5n9zc1, d5n9zc2
  • Chain 'D':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Thalassiosira hyalina [TaxId:1234817]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N9Z
    Domains in SCOPe 2.07: d5n9zd1, d5n9zd2
  • Chain 'E':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Thalassiosira hyalina [TaxId:1234817]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N9Z
    Domains in SCOPe 2.07: d5n9ze1, d5n9ze2
  • Chain 'F':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Thalassiosira hyalina [TaxId:1234817]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N9Z
    Domains in SCOPe 2.07: d5n9zf1, d5n9zf2
  • Chain 'G':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Thalassiosira hyalina [TaxId:1234817]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N9Z
    Domains in SCOPe 2.07: d5n9zg1, d5n9zg2
  • Chain 'H':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Thalassiosira hyalina [TaxId:1234817]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N9Z
    Domains in SCOPe 2.07: d5n9zh1, d5n9zh2
  • Chain 'I':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
    Species: Thalassiosira hyalina [TaxId:1234817]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N9Z (0-138)
    Domains in SCOPe 2.07: d5n9zi_
  • Chain 'J':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
    Species: Thalassiosira hyalina [TaxId:1234817]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N9Z (0-138)
    Domains in SCOPe 2.07: d5n9zj_
  • Chain 'K':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
    Species: Thalassiosira hyalina [TaxId:1234817]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N9Z (0-138)
    Domains in SCOPe 2.07: d5n9zk_
  • Chain 'L':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
    Species: Thalassiosira hyalina [TaxId:1234817]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N9Z (0-138)
    Domains in SCOPe 2.07: d5n9zl_
  • Chain 'M':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
    Species: Thalassiosira hyalina [TaxId:1234817]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N9Z (0-138)
    Domains in SCOPe 2.07: d5n9zm_
  • Chain 'N':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
    Species: Thalassiosira hyalina [TaxId:1234817]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N9Z (0-138)
    Domains in SCOPe 2.07: d5n9zn_
  • Chain 'O':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
    Species: Thalassiosira hyalina [TaxId:1234817]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N9Z (0-138)
    Domains in SCOPe 2.07: d5n9zo_
  • Chain 'P':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
    Species: Thalassiosira hyalina [TaxId:1234817]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N9Z (0-138)
    Domains in SCOPe 2.07: d5n9zp_
  • Heterogens: MG, CAP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5n9zA (A:)
    msqsvsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaa
    vagesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnl
    tasiignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkp
    klglsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevk
    gsylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhrag
    nstyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydvlrltelevn
    lpfgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqaga
    tanrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdta
    dfaetatanr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n9zA (A:)
    svsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaavag
    esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas
    iignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkpklg
    lsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevkgsy
    lnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhragnst
    yarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydvlrltelevnlpf
    giffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqagatan
    rvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdtadfa
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5n9zB (B:)
    msqsvsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaa
    vagesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnl
    tasiignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkp
    klglsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevk
    gsylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhrag
    nstyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydvlrltelevn
    lpfgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqaga
    tanrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdta
    dfaetatanr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n9zB (B:)
    svsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaavag
    esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas
    iignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkpklg
    lsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevkgsy
    lnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhragnst
    yarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydvlrltelevnlpf
    giffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqagatan
    rvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdtadfa
    e
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5n9zC (C:)
    msqsvsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaa
    vagesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnl
    tasiignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkp
    klglsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevk
    gsylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhrag
    nstyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydvlrltelevn
    lpfgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqaga
    tanrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdta
    dfaetatanr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n9zC (C:)
    svsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaavag
    esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas
    iignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkpklg
    lsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevkgsy
    lnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhragnst
    yarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydvlrltelevnlpf
    giffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqagatan
    rvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdtadfa
    e
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5n9zD (D:)
    msqsvsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaa
    vagesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnl
    tasiignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkp
    klglsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevk
    gsylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhrag
    nstyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydvlrltelevn
    lpfgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqaga
    tanrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdta
    dfaetatanr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n9zD (D:)
    svsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaavag
    esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas
    iignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkpklg
    lsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevkgsy
    lnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhragnst
    yarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydvlrltelevnlpf
    giffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqagatan
    rvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdtadfa
    e
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5n9zE (E:)
    msqsvsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaa
    vagesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnl
    tasiignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkp
    klglsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevk
    gsylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhrag
    nstyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydvlrltelevn
    lpfgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqaga
    tanrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdta
    dfaetatanr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n9zE (E:)
    svsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaavag
    esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas
    iignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkpklg
    lsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevkgsy
    lnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhragnst
    yarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydvlrltelevnlpf
    giffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqagatan
    rvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdtadfa
    e
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5n9zF (F:)
    msqsvsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaa
    vagesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnl
    tasiignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkp
    klglsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevk
    gsylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhrag
    nstyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydvlrltelevn
    lpfgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqaga
    tanrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdta
    dfaetatanr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n9zF (F:)
    svsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaavag
    esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas
    iignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkpklg
    lsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevkgsy
    lnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhragnst
    yarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydvlrltelevnlpf
    giffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqagatan
    rvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdtadfa
    e
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5n9zG (G:)
    msqsvsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaa
    vagesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnl
    tasiignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkp
    klglsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevk
    gsylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhrag
    nstyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydvlrltelevn
    lpfgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqaga
    tanrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdta
    dfaetatanr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n9zG (G:)
    svsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaavag
    esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas
    iignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkpklg
    lsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevkgsy
    lnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhragnst
    yarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydvlrltelevnlpf
    giffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqagatan
    rvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdtadfa
    e
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5n9zH (H:)
    msqsvsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaa
    vagesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnl
    tasiignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkp
    klglsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevk
    gsylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhrag
    nstyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydvlrltelevn
    lpfgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqaga
    tanrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdta
    dfaetatanr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n9zH (H:)
    svsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaavag
    esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas
    iignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkpklg
    lsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevkgsy
    lnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhragnst
    yarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydvlrltelevnlpf
    giffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqagatan
    rvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdtadfa
    e
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5n9zI (I:)
    mrltqgcfsflpdltdqqiekqvtyamnrgwamnvewtddphprnnywelwglplfdikd
    patvmfelnearkscaagyirvnafdasygtescvmsfitnrpanepgfyldrtegvgrq
    viysiksysvqanpegsry
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5n9zJ (J:)
    mrltqgcfsflpdltdqqiekqvtyamnrgwamnvewtddphprnnywelwglplfdikd
    patvmfelnearkscaagyirvnafdasygtescvmsfitnrpanepgfyldrtegvgrq
    viysiksysvqanpegsry
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5n9zK (K:)
    mrltqgcfsflpdltdqqiekqvtyamnrgwamnvewtddphprnnywelwglplfdikd
    patvmfelnearkscaagyirvnafdasygtescvmsfitnrpanepgfyldrtegvgrq
    viysiksysvqanpegsry
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5n9zL (L:)
    mrltqgcfsflpdltdqqiekqvtyamnrgwamnvewtddphprnnywelwglplfdikd
    patvmfelnearkscaagyirvnafdasygtescvmsfitnrpanepgfyldrtegvgrq
    viysiksysvqanpegsry
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5n9zM (M:)
    mrltqgcfsflpdltdqqiekqvtyamnrgwamnvewtddphprnnywelwglplfdikd
    patvmfelnearkscaagyirvnafdasygtescvmsfitnrpanepgfyldrtegvgrq
    viysiksysvqanpegsry
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5n9zN (N:)
    mrltqgcfsflpdltdqqiekqvtyamnrgwamnvewtddphprnnywelwglplfdikd
    patvmfelnearkscaagyirvnafdasygtescvmsfitnrpanepgfyldrtegvgrq
    viysiksysvqanpegsry
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5n9zO (O:)
    mrltqgcfsflpdltdqqiekqvtyamnrgwamnvewtddphprnnywelwglplfdikd
    patvmfelnearkscaagyirvnafdasygtescvmsfitnrpanepgfyldrtegvgrq
    viysiksysvqanpegsry
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5n9zP (P:)
    mrltqgcfsflpdltdqqiekqvtyamnrgwamnvewtddphprnnywelwglplfdikd
    patvmfelnearkscaagyirvnafdasygtescvmsfitnrpanepgfyldrtegvgrq
    viysiksysvqanpegsry