Lineage for d5n9zk_ (5n9z K:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957953Family d.73.1.0: automated matches [336551] (1 protein)
    not a true family
  6. 2957954Protein automated matches [336552] (9 species)
    not a true protein
  7. 2957995Species Thalassiosira hyalina [TaxId:1234817] [346774] (1 PDB entry)
  8. 2957998Domain d5n9zk_: 5n9z K: [346789]
    Other proteins in same PDB: d5n9za1, d5n9za2, d5n9zb1, d5n9zb2, d5n9zc1, d5n9zc2, d5n9zd1, d5n9zd2, d5n9ze1, d5n9ze2, d5n9zf1, d5n9zf2, d5n9zg1, d5n9zg2, d5n9zh1, d5n9zh2
    automated match to d1iwab_
    complexed with cap, edo, mg

Details for d5n9zk_

PDB Entry: 5n9z (more details), 1.9 Å

PDB Description: rubisco from thalassiosira hyalina
PDB Compounds: (K:) ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit

SCOPe Domain Sequences for d5n9zk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n9zk_ d.73.1.0 (K:) automated matches {Thalassiosira hyalina [TaxId: 1234817]}
mrltqgcfsflpdltdqqiekqvtyamnrgwamnvewtddphprnnywelwglplfdikd
patvmfelnearkscaagyirvnafdasygtescvmsfitnrpanepgfyldrtegvgrq
viysiksysvqanpegsry

SCOPe Domain Coordinates for d5n9zk_:

Click to download the PDB-style file with coordinates for d5n9zk_.
(The format of our PDB-style files is described here.)

Timeline for d5n9zk_: