Lineage for d5n9zf1 (5n9z F:4-153)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2519829Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2520025Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2520026Protein automated matches [226983] (24 species)
    not a true protein
  7. 3046702Species Thalassiosira hyalina [TaxId:1234817] [346764] (1 PDB entry)
  8. 3046715Domain d5n9zf1: 5n9z F:4-153 [346777]
    Other proteins in same PDB: d5n9za2, d5n9zb2, d5n9zc2, d5n9zd2, d5n9ze2, d5n9zf2, d5n9zg2, d5n9zh2, d5n9zi_, d5n9zj_, d5n9zk_, d5n9zl_, d5n9zm_, d5n9zn_, d5n9zo_, d5n9zp_
    automated match to d1bwva2
    complexed with cap, edo, mg

Details for d5n9zf1

PDB Entry: 5n9z (more details), 1.9 Å

PDB Description: rubisco from thalassiosira hyalina
PDB Compounds: (F:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d5n9zf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n9zf1 d.58.9.0 (F:4-153) automated matches {Thalassiosira hyalina [TaxId: 1234817]}
svsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaavag
esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas
iignvfgfkaisalrledmriphsylxtfq

SCOPe Domain Coordinates for d5n9zf1:

Click to download the PDB-style file with coordinates for d5n9zf1.
(The format of our PDB-style files is described here.)

Timeline for d5n9zf1:

  • d5n9zf1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06