![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
![]() | Protein automated matches [226983] (27 species) not a true protein |
![]() | Species Thalassiosira hyalina [TaxId:1234817] [346764] (1 PDB entry) |
![]() | Domain d5n9zg1: 5n9z G:4-153 [347019] Other proteins in same PDB: d5n9za2, d5n9zb2, d5n9zc2, d5n9zd2, d5n9ze2, d5n9zf2, d5n9zg2, d5n9zh2, d5n9zi_, d5n9zj_, d5n9zk_, d5n9zl_, d5n9zm_, d5n9zn_, d5n9zo_, d5n9zp_ automated match to d1bwva2 complexed with cap, edo, mg |
PDB Entry: 5n9z (more details), 1.9 Å
SCOPe Domain Sequences for d5n9zg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n9zg1 d.58.9.0 (G:4-153) automated matches {Thalassiosira hyalina [TaxId: 1234817]} svsertriksdryesgvipyakmgywdaaysvkdtdvlalfritpqpgvdpveaaaavag esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas iignvfgfkaisalrledmriphsylxtfq
Timeline for d5n9zg1: