Lineage for d5n9zl_ (5n9z L:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524228Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2524229Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2524488Family d.73.1.0: automated matches [336551] (1 protein)
    not a true family
  6. 2524489Protein automated matches [336552] (6 species)
    not a true protein
  7. 3046712Species Thalassiosira hyalina [TaxId:1234817] [346774] (1 PDB entry)
  8. 3046786Domain d5n9zl_: 5n9z L: [346848]
    Other proteins in same PDB: d5n9za1, d5n9za2, d5n9zb1, d5n9zb2, d5n9zc1, d5n9zc2, d5n9zd1, d5n9zd2, d5n9ze1, d5n9ze2, d5n9zf1, d5n9zf2, d5n9zg1, d5n9zg2, d5n9zh1, d5n9zh2
    automated match to d1iwab_
    complexed with cap, edo, mg

Details for d5n9zl_

PDB Entry: 5n9z (more details), 1.9 Å

PDB Description: rubisco from thalassiosira hyalina
PDB Compounds: (L:) ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit

SCOPe Domain Sequences for d5n9zl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n9zl_ d.73.1.0 (L:) automated matches {Thalassiosira hyalina [TaxId: 1234817]}
mrltqgcfsflpdltdqqiekqvtyamnrgwamnvewtddphprnnywelwglplfdikd
patvmfelnearkscaagyirvnafdasygtescvmsfitnrpanepgfyldrtegvgrq
viysiksysvqanpegsry

SCOPe Domain Coordinates for d5n9zl_:

Click to download the PDB-style file with coordinates for d5n9zl_.
(The format of our PDB-style files is described here.)

Timeline for d5n9zl_:

  • d5n9zl_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-06