SCOPe 2.08: Domain d5gzzf1: 5gzz F:1-80

Lineage for d5gzzf1 (5gzz F:1-80)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Schistosoma japonicum [TaxId:6182] [225614] (9 PDB entries)

8. Domain d5gzzf1: 5gzz F:1-80 [329743]
   Other proteins in same PDB: d5gzzb1, d5gzzb2, d5gzzc1, d5gzzc2, d5gzzd1, d5gzzd2, d5gzze2, d5gzzf2, d5gzzg1, d5gzzg2
   automated match to d3isoa1
   complexed with gsh, jaa

Details for d5gzzf1

PDB Entry: 5gzz, 2.39 Å

PDB Description: crystal structure of fin219-sjgst complex with ja

PDB Compounds: (F:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d5gzzf1:

Sequence; same for both SEQRES and ATOM records:

>d5gzzf1 c.47.1.0 (F:1-80) automated matches {Schistosoma japonicum [TaxId: 6182]}
mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
gdvkltqsmaiiryiadkhn

Timeline for d5gzzf1:

• d5gzzf1 first appeared in SCOPe 2.06
  
• d5gzzf1 appears in SCOPe 2.07