Lineage for d5gzzg2 (5gzz G:81-216)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2712845Protein Class alpha GST [81349] (8 species)
  7. 2712988Species Schistosoma japonicum [TaxId:6182] [47633] (15 PDB entries)
    Uniprot P08515
  8. 2713004Domain d5gzzg2: 5gzz G:81-216 [329718]
    Other proteins in same PDB: d5gzzb1, d5gzzc1, d5gzzd1, d5gzze1, d5gzze2, d5gzzf1, d5gzzf2, d5gzzg1
    automated match to d1m9aa1
    complexed with gsh, jaa

Details for d5gzzg2

PDB Entry: 5gzz (more details), 2.39 Å

PDB Description: crystal structure of fin219-sjgst complex with ja
PDB Compounds: (G:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d5gzzg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gzzg2 a.45.1.1 (G:81-216) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhp

SCOPe Domain Coordinates for d5gzzg2:

Click to download the PDB-style file with coordinates for d5gzzg2.
(The format of our PDB-style files is described here.)

Timeline for d5gzzg2: