![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class alpha GST [81349] (8 species) |
![]() | Species Schistosoma japonicum [TaxId:6182] [47633] (15 PDB entries) Uniprot P08515 |
![]() | Domain d5gzzd2: 5gzz D:81-216 [329724] Other proteins in same PDB: d5gzzb1, d5gzzc1, d5gzzd1, d5gzze1, d5gzze2, d5gzzf1, d5gzzf2, d5gzzg1 automated match to d1m9aa1 complexed with gsh, jaa |
PDB Entry: 5gzz (more details), 2.39 Å
SCOPe Domain Sequences for d5gzzd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gzzd2 a.45.1.1 (D:81-216) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia wplqgwqatfgggdhp
Timeline for d5gzzd2: