PDB entry 5gzz

View 5gzz on RCSB PDB site
Description: Crystal Structure of FIN219-SjGST complex with JA
Class: ligase/transferase
Keywords: Jasmonate-amido synthetase, Glutathione S-transferase, Ligase-Transferase complex
Deposited on 2016-10-02, released 2017-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Jasmonic acid-amido synthetase JAR1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: JAR1, FIN219, AtGH3.11
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Glutathione S-transferase class-mu 26 kDa isozyme
    Species: Schistosoma japonicum [TaxId:6182]
    Gene: SjGST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gzzb1, d5gzzb2
  • Chain 'C':
    Compound: Glutathione S-transferase class-mu 26 kDa isozyme
    Species: Schistosoma japonicum [TaxId:6182]
    Gene: SjGST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gzzc1, d5gzzc2
  • Chain 'D':
    Compound: Glutathione S-transferase class-mu 26 kDa isozyme
    Species: Schistosoma japonicum [TaxId:6182]
    Gene: SjGST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gzzd1, d5gzzd2
  • Chain 'E':
    Compound: Glutathione S-transferase class-mu 26 kDa isozyme
    Species: Schistosoma japonicum [TaxId:6182]
    Gene: SjGST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gzze1, d5gzze2
  • Chain 'F':
    Compound: Glutathione S-transferase class-mu 26 kDa isozyme
    Species: Schistosoma japonicum [TaxId:6182]
    Gene: SjGST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gzzf1, d5gzzf2
  • Chain 'G':
    Compound: Glutathione S-transferase class-mu 26 kDa isozyme
    Species: Schistosoma japonicum [TaxId:6182]
    Gene: SjGST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gzzg1, d5gzzg2
  • Heterogens: JAA, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gzzB (B:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gzzB (B:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gzzC (C:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gzzC (C:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gzzD (D:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gzzD (D:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5gzzE (E:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gzzE (E:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5gzzF (F:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gzzF (F:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5gzzG (G:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gzzG (G:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhp