Lineage for d5gzzb1 (5gzz B:1-80)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876600Protein Class alpha GST [81360] (8 species)
  7. 2876743Species Schistosoma japonicum [TaxId:6182] [52878] (15 PDB entries)
    Uniprot P08515
  8. 2876756Domain d5gzzb1: 5gzz B:1-80 [329849]
    Other proteins in same PDB: d5gzzb2, d5gzzc2, d5gzzd2, d5gzze1, d5gzze2, d5gzzf1, d5gzzf2, d5gzzg2
    automated match to d1m9aa2
    complexed with gsh, jaa

Details for d5gzzb1

PDB Entry: 5gzz (more details), 2.39 Å

PDB Description: crystal structure of fin219-sjgst complex with ja
PDB Compounds: (B:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d5gzzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gzzb1 c.47.1.5 (B:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
gdvkltqsmaiiryiadkhn

SCOPe Domain Coordinates for d5gzzb1:

Click to download the PDB-style file with coordinates for d5gzzb1.
(The format of our PDB-style files is described here.)

Timeline for d5gzzb1: