SCOPe 2.07: Domain d5gzze2: 5gzz E:81-216

Lineage for d5gzze2 (5gzz E:81-216)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (65 species)
   not a true protein

7. Species Schistosoma japonicum [TaxId:6182] [276183] (3 PDB entries)

8. Domain d5gzze2: 5gzz E:81-216 [329782]
   Other proteins in same PDB: d5gzzb1, d5gzzb2, d5gzzc1, d5gzzc2, d5gzzd1, d5gzzd2, d5gzze1, d5gzzf1, d5gzzg1, d5gzzg2
   automated match to d3isoa2
   complexed with gsh, jaa

Details for d5gzze2

PDB Entry: 5gzz, 2.39 Å

PDB Description: crystal structure of fin219-sjgst complex with ja

PDB Compounds: (E:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d5gzze2:

Sequence; same for both SEQRES and ATOM records:

>d5gzze2 a.45.1.0 (E:81-216) automated matches {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhp

Timeline for d5gzze2:

• d5gzze2 first appeared in SCOPe 2.06