SCOPe 2.08: Domain d4kuhd2: 4kuh D:184-280

Lineage for d4kuhd2 (4kuh D:184-280)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Clostridium butyricum [TaxId:632245] [256902] (4 PDB entries)

8. Domain d4kuhd2: 4kuh D:184-280 [262867]
   Other proteins in same PDB: d4kuha1, d4kuhb1, d4kuhc1, d4kuhd1, d4kuhe1, d4kuhf1, d4kuhg1, d4kuhh1
   automated match to d4kuga2
   complexed with caa

Details for d4kuhd2

PDB Entry: 4kuh, 2.51 Å

PDB Description: crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum

PDB Compounds: (D:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d4kuhd2:

Sequence; same for both SEQRES and ATOM records:

>d4kuhd2 a.100.1.0 (D:184-280) automated matches {Clostridium butyricum [TaxId: 632245]}
gfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvclaimd
vlynetgdtkyrassllrkyvragwlgrktgkgfydy

Timeline for d4kuhd2:

• d4kuhd2 first appeared in SCOPe 2.05
  
• d4kuhd2 appears in SCOPe 2.07