![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
![]() | Protein automated matches [226851] (46 species) not a true protein |
![]() | Species Clostridium butyricum [TaxId:632245] [256902] (4 PDB entries) |
![]() | Domain d4kuhe2: 4kuh E:184-280 [262869] Other proteins in same PDB: d4kuha1, d4kuhb1, d4kuhc1, d4kuhd1, d4kuhe1, d4kuhf1, d4kuhg1, d4kuhh1 automated match to d4kuga2 complexed with caa |
PDB Entry: 4kuh (more details), 2.51 Å
SCOPe Domain Sequences for d4kuhe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kuhe2 a.100.1.0 (E:184-280) automated matches {Clostridium butyricum [TaxId: 632245]} gfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvclaimd vlynetgdtkyrassllrkyvragwlgrktgkgfydy
Timeline for d4kuhe2: