Lineage for d4kuhe1 (4kuh E:1-183)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846566Species Clostridium butyricum [TaxId:632245] [256900] (4 PDB entries)
  8. 2846583Domain d4kuhe1: 4kuh E:1-183 [262868]
    Other proteins in same PDB: d4kuha2, d4kuhb2, d4kuhc2, d4kuhd2, d4kuhe2, d4kuhf2, d4kuhg2, d4kuhh2
    automated match to d4kuea1
    complexed with caa

Details for d4kuhe1

PDB Entry: 4kuh (more details), 2.51 Å

PDB Description: crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
PDB Compounds: (E:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d4kuhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kuhe1 c.2.1.0 (E:1-183) automated matches {Clostridium butyricum [TaxId: 632245]}
mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
eap

SCOPe Domain Coordinates for d4kuhe1:

Click to download the PDB-style file with coordinates for d4kuhe1.
(The format of our PDB-style files is described here.)

Timeline for d4kuhe1: