| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Clostridium butyricum [TaxId:632245] [256900] (4 PDB entries) |
| Domain d4kuhc1: 4kuh C:1-183 [262864] Other proteins in same PDB: d4kuha2, d4kuhb2, d4kuhc2, d4kuhd2, d4kuhe2, d4kuhf2, d4kuhg2, d4kuhh2 automated match to d4kuea1 complexed with caa |
PDB Entry: 4kuh (more details), 2.51 Å
SCOPe Domain Sequences for d4kuhc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kuhc1 c.2.1.0 (C:1-183) automated matches {Clostridium butyricum [TaxId: 632245]}
mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
eap
Timeline for d4kuhc1: