SCOPe 2.08: Domain d4kuhb1: 4kuh B:1-183

Lineage for d4kuhb1 (4kuh B:1-183)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Clostridium butyricum [TaxId:632245] [256900] (4 PDB entries)

8. Domain d4kuhb1: 4kuh B:1-183 [256908]
   Other proteins in same PDB: d4kuha2, d4kuhb2, d4kuhc2, d4kuhd2, d4kuhe2, d4kuhf2, d4kuhg2, d4kuhh2
   automated match to d1f0ya2
   complexed with caa

Details for d4kuhb1

PDB Entry: 4kuh, 2.51 Å

PDB Description: crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum

PDB Compounds: (B:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d4kuhb1:

Sequence; same for both SEQRES and ATOM records:

>d4kuhb1 c.2.1.0 (B:1-183) automated matches {Clostridium butyricum [TaxId: 632245]}
mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
eap

Timeline for d4kuhb1:

• d4kuhb1 first appeared in SCOPe 2.04
  
• d4kuhb1 appears in SCOPe 2.07