PDB entry 4kuh

View 4kuh on RCSB PDB site
Description: Crystal structure of 3-hydroxybutylryl-CoA dehydrogenase with acetoacetyl-CoA from Clostridium butyricum
Class: oxidoreductase
Keywords: HCDH C-domain-like/NAD(P)-binding protein, beta-hydroxyacyl-CoA dehydrogenase activity, Oxidoreductase
Deposited on 2013-05-22, released 2014-05-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium butyricum [TaxId:632245]
    Gene: hbd, CLP_3850
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kuha1, d4kuha2
  • Chain 'B':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium butyricum [TaxId:632245]
    Gene: hbd, CLP_3850
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kuhb1, d4kuhb2
  • Chain 'C':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium butyricum [TaxId:632245]
    Gene: hbd, CLP_3850
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kuhc1, d4kuhc2
  • Chain 'D':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium butyricum [TaxId:632245]
    Gene: hbd, CLP_3850
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kuhd1, d4kuhd2
  • Chain 'E':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium butyricum [TaxId:632245]
    Gene: hbd, CLP_3850
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kuhe1, d4kuhe2
  • Chain 'F':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium butyricum [TaxId:632245]
    Gene: hbd, CLP_3850
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kuhf1, d4kuhf2
  • Chain 'G':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium butyricum [TaxId:632245]
    Gene: hbd, CLP_3850
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kuhg1, d4kuhg2
  • Chain 'H':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium butyricum [TaxId:632245]
    Gene: hbd, CLP_3850
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kuhh1, d4kuhh2
  • Heterogens: CAA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kuhA (A:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kuhA (A:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kuhB (B:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kuhB (B:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kuhC (C:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kuhC (C:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kuhD (D:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kuhD (D:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4kuhE (E:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kuhE (E:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydy
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4kuhF (F:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kuhF (F:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydy
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4kuhG (G:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kuhG (G:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydy
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4kuhH (H:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kuhH (H:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydy