Lineage for d4kuhb2 (4kuh B:184-280)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721567Species Clostridium butyricum [TaxId:632245] [256902] (4 PDB entries)
  8. 2721581Domain d4kuhb2: 4kuh B:184-280 [256909]
    Other proteins in same PDB: d4kuha1, d4kuhb1, d4kuhc1, d4kuhd1, d4kuhe1, d4kuhf1, d4kuhg1, d4kuhh1
    automated match to d1f0ya1
    complexed with caa

Details for d4kuhb2

PDB Entry: 4kuh (more details), 2.51 Å

PDB Description: crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
PDB Compounds: (B:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d4kuhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kuhb2 a.100.1.0 (B:184-280) automated matches {Clostridium butyricum [TaxId: 632245]}
gfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvclaimd
vlynetgdtkyrassllrkyvragwlgrktgkgfydy

SCOPe Domain Coordinates for d4kuhb2:

Click to download the PDB-style file with coordinates for d4kuhb2.
(The format of our PDB-style files is described here.)

Timeline for d4kuhb2: