| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
| Family d.20.1.1: UBC-related [54496] (7 proteins) |
| Protein automated matches [190124] (13 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries) |
| Domain d3vonl_: 3von L: [250636] Other proteins in same PDB: d3vona_, d3vonb_, d3vond_, d3vonf_, d3vonh_, d3voni_, d3vonk_, d3vonm_, d3vono_, d3vonp_, d3vonr_, d3vont_, d3vonv_, d3vonw_, d3vony_ automated match to d2c2vb_ |
PDB Entry: 3von (more details), 3.15 Å
SCOPe Domain Sequences for d3vonl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vonl_ d.20.1.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddplan
dvaeqwktneaqaietarawtrlyamn
Timeline for d3vonl_: