![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
![]() | Species Human (Homo sapiens), mms2 [TaxId:9606] [64242] (6 PDB entries) |
![]() | Domain d3vont_: 3von T: [250644] Other proteins in same PDB: d3vona_, d3vonc_, d3vone_, d3vong_, d3vonh_, d3vonj_, d3vonl_, d3vonn_, d3vono_, d3vonq_, d3vons_, d3vonu_, d3vonv_, d3vonx_, d3vonz_ automated match to d1j7da_ |
PDB Entry: 3von (more details), 3.15 Å
SCOPe Domain Sequences for d3vont_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vont_ d.20.1.1 (T:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), mms2 [TaxId: 9606]} gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl mmskenmklpqppegqty
Timeline for d3vont_: