PDB entry 3von

View 3von on RCSB PDB site
Description: Crystalstructure of the ubiquitin protease
Class: hydrolase/ligase
Keywords: ubiquitin protease, HYDROLASE-LIGASE complex
Deposited on 2012-01-30, released 2012-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.226
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin thioesterase OTUB1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPC263, OTB1, OTU1, OTUB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vona_
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vonb_
  • Chain 'C':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vonc_
  • Chain 'D':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vond_
  • Chain 'E':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vone_
  • Chain 'F':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vonf_
  • Chain 'G':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vong_
  • Chain 'H':
    Compound: Ubiquitin thioesterase OTUB1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPC263, OTB1, OTU1, OTUB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vonh_
  • Chain 'I':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3voni_
  • Chain 'J':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vonj_
  • Chain 'K':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vonk_
  • Chain 'L':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vonl_
  • Chain 'M':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vonm_
  • Chain 'N':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vonn_
  • Chain 'O':
    Compound: Ubiquitin thioesterase OTUB1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPC263, OTB1, OTU1, OTUB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vono_
  • Chain 'P':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vonp_
  • Chain 'Q':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vonq_
  • Chain 'R':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vonr_
  • Chain 'S':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vons_
  • Chain 'T':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vont_
  • Chain 'U':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vonu_
  • Chain 'V':
    Compound: Ubiquitin thioesterase OTUB1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPC263, OTB1, OTU1, OTUB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vonv_
  • Chain 'W':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vonw_
  • Chain 'X':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vonx_
  • Chain 'Y':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vony_
  • Chain 'Z':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vonz_
  • Chain 'a':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: Ubiquitin thioesterase OTUB1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPC263, OTB1, OTU1, OTUB1
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Ubiquitin thioesterase OTUB1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPC263, OTB1, OTU1, OTUB1
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed):
  • Chain 'p':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vonA (A:)
    snplvserlelsvlykeyaeddniyqqkikdlhkkysyirktrpdgncfyrafgfshlea
    llddskelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfn
    dqstsdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiial
    aqalsvsiqveymdrgeggttnphifpegsepkvyllyrpghydilyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vonA (A:)
    nplvserlelsvlykeqqkikdlhkkysyirktrpdgncfyrafgfshleallddskelq
    rfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfndqstsdylv
    vylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiialaqalsvsiq
    veymdphifpegsepkvyllyrpghydily
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vonB (B:)
    gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
    kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
    mmskenmklpqppegqty
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3vonC (C:)
    glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
    pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
    ndvaeqwktneaqaietarawtrlyamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vonC (C:)
    lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
    maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddplan
    dvaeqwktneaqaietarawtrlyamn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3vonD (D:)
    gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
    kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
    mmskenmklpqppegqty
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vonD (D:)
    vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriyslk
    vecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrlm
    mskenmklpqppegqty
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3vonE (E:)
    glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
    pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
    ndvaeqwktneaqaietarawtrlyamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vonE (E:)
    lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
    maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddplan
    dvaeqwktneaqaietarawtrlyamn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vonF (F:)
    gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
    kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
    mmskenmklpqppegqty
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3vonG (G:)
    glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
    pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
    ndvaeqwktneaqaietarawtrlyamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vonG (G:)
    lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
    maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddplan
    dvaeqwktneaqaietarawtrlyamn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3vonH (H:)
    snplvserlelsvlykeyaeddniyqqkikdlhkkysyirktrpdgncfyrafgfshlea
    llddskelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfn
    dqstsdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiial
    aqalsvsiqveymdrgeggttnphifpegsepkvyllyrpghydilyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vonH (H:)
    nplvserlelsvlykeddniyqqkikdlhkkysyirktrpdgncfyrafgfshlealldd
    skelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfndqst
    sdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiialaqal
    svsiqveynphifpegsepkvyllyrpghydily
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vonI (I:)
    gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
    kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
    mmskenmklpqppegqty
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3vonJ (J:)
    glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
    pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
    ndvaeqwktneaqaietarawtrlyamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vonJ (J:)
    lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
    maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddplan
    dvaeqwktneaqaietarawtrlyamn
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vonK (K:)
    gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
    kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
    mmskenmklpqppegqty
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3vonL (L:)
    glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
    pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
    ndvaeqwktneaqaietarawtrlyamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vonL (L:)
    lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
    maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddplan
    dvaeqwktneaqaietarawtrlyamn
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vonM (M:)
    gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
    kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
    mmskenmklpqppegqty
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3vonN (N:)
    glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
    pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
    ndvaeqwktneaqaietarawtrlyamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vonN (N:)
    lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
    maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddplan
    dvaeqwktneaqaietarawtrlyamn
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3vonO (O:)
    snplvserlelsvlykeyaeddniyqqkikdlhkkysyirktrpdgncfyrafgfshlea
    llddskelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfn
    dqstsdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiial
    aqalsvsiqveymdrgeggttnphifpegsepkvyllyrpghydilyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vonO (O:)
    nplvserlelsvlykeyaniyqqkikdlhkkysyirktrpdgncfyrafgfshlealldd
    skelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfndqst
    sdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiialaqal
    svsiqveymdphifpegsepkvyllyrpghydilyk
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vonP (P:)
    gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
    kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
    mmskenmklpqppegqty
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3vonQ (Q:)
    glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
    pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
    ndvaeqwktneaqaietarawtrlyamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vonQ (Q:)
    lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
    maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddplan
    dvaeqwktneaqaietarawtrlyamn
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3vonR (R:)
    gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
    kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
    mmskenmklpqppegqty
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vonR (R:)
    vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriyslk
    vecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrlm
    mskenmklpqppegqty
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vonS (S:)
    glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
    pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
    ndvaeqwktneaqaietarawtrlyamn
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vonT (T:)
    gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
    kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
    mmskenmklpqppegqty
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3vonU (U:)
    glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
    pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
    ndvaeqwktneaqaietarawtrlyamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vonU (U:)
    lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
    maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddplan
    dvaeqwktneaqaietarawtrlyamn
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3vonV (V:)
    snplvserlelsvlykeyaeddniyqqkikdlhkkysyirktrpdgncfyrafgfshlea
    llddskelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfn
    dqstsdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiial
    aqalsvsiqveymdrgeggttnphifpegsepkvyllyrpghydilyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vonV (V:)
    nplvserlelsvlykeniyqqkikdlhkkysyirktrpdgncfyrafgfshleallddsk
    elqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfndqstsd
    ylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiialaqalsv
    siqveymdnphifpegsepkvyllyrpghydilyk
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3vonW (W:)
    gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
    kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
    mmskenmklpqppegqty
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vonW (W:)
    vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriyslk
    vecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrlm
    mskenmklpqppegqty
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3vonX (X:)
    glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
    pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
    ndvaeqwktneaqaietarawtrlyamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vonX (X:)
    lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
    maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddplan
    dvaeqwktneaqaietarawtrlyamn
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3vonY (Y:)
    gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
    kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
    mmskenmklpqppegqty
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vonY (Y:)
    vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriyslk
    vecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrlm
    mskenmklpqppegqty
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vonZ (Z:)
    glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
    pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
    ndvaeqwktneaqaietarawtrlyamn
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.

  • Chain 'g':
    No sequence available.

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.

  • Chain 'n':
    No sequence available.

  • Chain 'o':
    No sequence available.

  • Chain 'p':
    No sequence available.