SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3vonm_ (3von M:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164135Family d.20.1.1: UBC-related [54496] (7 protein domains)
  6. 2164143Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 2164216Species Human (Homo sapiens), mms2 [TaxId:9606] [64242] (6 PDB entries)
  8. 2164226Domain d3vonm_: 3von M: [250637]
    Other proteins in same PDB: d3vona_, d3vonc_, d3vone_, d3vong_, d3vonh_, d3vonj_, d3vonl_, d3vonn_, d3vono_, d3vonq_, d3vons_, d3vonu_, d3vonv_, d3vonx_, d3vonz_
    automated match to d1j7da_

Details for d3vonm_

PDB Entry: 3von (more details), 3.15 Å

PDB Description: Crystalstructure of the ubiquitin protease
PDB Compounds: (M:) Ubiquitin-conjugating enzyme E2 variant 2

SCOPe Domain Sequences for d3vonm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vonm_ d.20.1.1 (M:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), mms2 [TaxId: 9606]}
gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
mmskenmklpqppegqty

SCOPe Domain Coordinates for d3vonm_:

Click to download the PDB-style file with coordinates for d3vonm_.
(The format of our PDB-style files is described here.)

Timeline for d3vonm_: