![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein automated matches [190124] (13 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries) |
![]() | Domain d3vonu_: 3von U: [250645] Other proteins in same PDB: d3vona_, d3vonb_, d3vond_, d3vonf_, d3vonh_, d3voni_, d3vonk_, d3vonm_, d3vono_, d3vonp_, d3vonr_, d3vont_, d3vonv_, d3vonw_, d3vony_ automated match to d2c2vb_ |
PDB Entry: 3von (more details), 3.15 Å
SCOPe Domain Sequences for d3vonu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vonu_ d.20.1.1 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddplan dvaeqwktneaqaietarawtrlyamn
Timeline for d3vonu_: