SCOPe 2.08: Domain d2wbjf1: 2wbj F:3-92

Lineage for d2wbjf1 (2wbj F:3-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries)

8. Domain d2wbjf1: 2wbj F:3-92 [244092]
   Other proteins in same PDB: d2wbja1, d2wbja2, d2wbjb2, d2wbjc1, d2wbjc2, d2wbje1, d2wbje2, d2wbjf2, d2wbjg1, d2wbjg2
   automated match to d1klub2
   complexed with nag, so4

Details for d2wbjf1

PDB Entry: 2wbj, 3 Å

PDB Description: tcr complex

PDB Compounds: (F:) hla class II histocompatibility antigen, drb1-15 beta chain

SCOPe Domain Sequences for d2wbjf1:

Sequence; same for both SEQRES and ATOM records:

>d2wbjf1 d.19.1.1 (F:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trprflwqpkrechffngtervrfldryfynqeesvrfdsdvgefravtelgrpdaeywn
sqkdileqaraavdtycrhnygvvesftvq

Timeline for d2wbjf1:

• d2wbjf1 first appeared in SCOPe 2.04
  
• d2wbjf1 appears in SCOPe 2.07