Lineage for d2wbjf1 (2wbj F:3-92)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2507461Protein automated matches [191280] (4 species)
    not a true protein
  7. 2507471Species Human (Homo sapiens) [TaxId:9606] [189896] (25 PDB entries)
  8. 2507510Domain d2wbjf1: 2wbj F:3-92 [244092]
    Other proteins in same PDB: d2wbja1, d2wbja2, d2wbjb2, d2wbjc1, d2wbjc2, d2wbje1, d2wbje2, d2wbjf2, d2wbjg1, d2wbjg2
    automated match to d1klub2
    complexed with nag, so4

Details for d2wbjf1

PDB Entry: 2wbj (more details), 3 Å

PDB Description: TCR complex
PDB Compounds: (F:) hla class II histocompatibility antigen, drb1-15 beta chain

SCOPe Domain Sequences for d2wbjf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wbjf1 d.19.1.1 (F:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trprflwqpkrechffngtervrfldryfynqeesvrfdsdvgefravtelgrpdaeywn
sqkdileqaraavdtycrhnygvvesftvq

SCOPe Domain Coordinates for d2wbjf1:

Click to download the PDB-style file with coordinates for d2wbjf1.
(The format of our PDB-style files is described here.)

Timeline for d2wbjf1: