Lineage for d2wbja2 (2wbj A:82-180)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758711Domain d2wbja2: 2wbj A:82-180 [244085]
    Other proteins in same PDB: d2wbja1, d2wbjb1, d2wbjb2, d2wbjc2, d2wbje1, d2wbjf1, d2wbjf2, d2wbjg2
    automated match to d1ieaa1
    complexed with nag, so4

Details for d2wbja2

PDB Entry: 2wbj (more details), 3 Å

PDB Description: tcr complex
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2wbja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wbja2 b.1.1.0 (A:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

SCOPe Domain Coordinates for d2wbja2:

Click to download the PDB-style file with coordinates for d2wbja2.
(The format of our PDB-style files is described here.)

Timeline for d2wbja2: