| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein automated matches [191280] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries) |
| Domain d2wbjb1: 2wbj B:3-92 [244086] Other proteins in same PDB: d2wbja1, d2wbja2, d2wbjb2, d2wbjc1, d2wbjc2, d2wbje1, d2wbje2, d2wbjf2, d2wbjg1, d2wbjg2 automated match to d1klub2 complexed with nag, so4 |
PDB Entry: 2wbj (more details), 3 Å
SCOPe Domain Sequences for d2wbjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wbjb1 d.19.1.1 (B:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trprflwqpkrechffngtervrfldryfynqeesvrfdsdvgefravtelgrpdaeywn
sqkdileqaraavdtycrhnygvvesftvq
Timeline for d2wbjb1: