Lineage for d2wbjc2 (2wbj C:114-200)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751986Domain d2wbjc2: 2wbj C:114-200 [244089]
    Other proteins in same PDB: d2wbja1, d2wbja2, d2wbjb1, d2wbjc1, d2wbje1, d2wbje2, d2wbjf1, d2wbjg1
    automated match to d2f54d2
    complexed with nag, so4

Details for d2wbjc2

PDB Entry: 2wbj (more details), 3 Å

PDB Description: tcr complex
PDB Compounds: (C:) ob tcr

SCOPe Domain Sequences for d2wbjc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wbjc2 b.1.1.2 (C:114-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtff

SCOPe Domain Coordinates for d2wbjc2:

Click to download the PDB-style file with coordinates for d2wbjc2.
(The format of our PDB-style files is described here.)

Timeline for d2wbjc2: