Lineage for d2wbjc1 (2wbj C:8-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758712Domain d2wbjc1: 2wbj C:8-113 [244088]
    Other proteins in same PDB: d2wbja1, d2wbjb1, d2wbjb2, d2wbjc2, d2wbje1, d2wbjf1, d2wbjf2, d2wbjg2
    automated match to d2f54d1
    complexed with nag, so4

Details for d2wbjc1

PDB Entry: 2wbj (more details), 3 Å

PDB Description: tcr complex
PDB Compounds: (C:) ob tcr

SCOPe Domain Sequences for d2wbjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wbjc1 b.1.1.0 (C:8-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqalsiqegenatmncsyktsinnlqwyrqnsgrglvhlilirsnerekhsgrlrvtldt
skksssllitasraadtasyfcatdttsgtykyifgtgtrlkvlpn

SCOPe Domain Coordinates for d2wbjc1:

Click to download the PDB-style file with coordinates for d2wbjc1.
(The format of our PDB-style files is described here.)

Timeline for d2wbjc1: