SCOPe 2.08: Domain d2wbja1: 2wbj A:3-81

Lineage for d2wbja1 (2wbj A:3-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d2wbja1: 2wbj A:3-81 [244084]
   Other proteins in same PDB: d2wbja2, d2wbjb1, d2wbjb2, d2wbjc1, d2wbjc2, d2wbje2, d2wbjf1, d2wbjf2, d2wbjg1, d2wbjg2
   automated match to d1fnga2
   complexed with nag, so4

Details for d2wbja1

PDB Entry: 2wbj, 3 Å

PDB Description: tcr complex

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2wbja1:

Sequence; same for both SEQRES and ATOM records:

>d2wbja1 d.19.1.0 (A:3-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

Timeline for d2wbja1:

• d2wbja1 first appeared in SCOPe 2.04
  
• d2wbja1 appears in SCOPe 2.07