SCOPe 2.08: Domain d3tkyb1: 3tky B:9-122

Lineage for d3tkyb1 (3tky B:9-122)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Clarkia breweri [TaxId:36903] [226317] (5 PDB entries)

8. Domain d3tkyb1: 3tky B:9-122 [216859]
   Other proteins in same PDB: d3tkya2, d3tkyb2, d3tkyc2, d3tkyd2
   automated match to d1kyze1
   complexed with n7i, sah

Details for d3tkyb1

PDB Entry: 3tky, 2.47 Å

PDB Description: monolignol o-methyltransferase (momt)

PDB Compounds: (B:) (Iso)eugenol O-methyltransferase

SCOPe Domain Sequences for d3tkyb1:

Sequence, based on SEQRES records:

>d3tkyb1 a.4.5.0 (B:9-122) automated matches {Clarkia breweri [TaxId: 36903]}
iqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaq
lpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne

Sequence, based on observed residues (ATOM records):

>d3tkyb1 a.4.5.0 (B:9-122) automated matches {Clarkia breweri [TaxId: 36903]}
iqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvgyispaeiaaqlpt
tnpeapvmldrvlrllasysvvtytlrerlyglapvckfltkne

Timeline for d3tkyb1:

• d3tkyb1 first appeared in SCOPe 2.03
  
• d3tkyb1 appears in SCOPe 2.07